SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004268 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004268
Domain Number 1 Region: 141-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-40
Family L-arabinose binding protein-like 0.0015
Further Details:      
 
Domain Number 2 Region: 344-547
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.82e-30
Family L-arabinose binding protein-like 0.0045
Further Details:      
 
Domain Number 3 Region: 73-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000195
Family Complement control module/SCR domain 0.0000354
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000361
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004268   Gene: ENSDORG00000004559   Transcript: ENSDORT00000004559
Sequence length 932
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6624:32480:63226:-1 gene:ENSDORG00000004559 transcript:ENSDORT00000004559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTD
MDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQGQ
WSTPKPHCQVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDY
ELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGS
SSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFCEVYKERLFGKKYV
WFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEK
LTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQI
YRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWI
GGAPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNL
NNLTAVGCSLALAAVFPLGLDGYHIRENQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVH
TVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDLLTLAIWQIVDPLHRTIETFAKEEPKED
IDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAI
YNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSE
AQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPQ
TPPDPSGGLPRGPSEPPDRLSCDGSRVHLLYK
Download sequence
Identical sequences ENSDORP00000004268 ENSDORP00000004268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]