SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004311 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004311
Domain Number 1 Region: 12-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.77e-45
Family Galectin (animal S-lectin) 0.00019
Further Details:      
 
Domain Number 2 Region: 222-357
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.47e-42
Family Galectin (animal S-lectin) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004311   Gene: ENSDORG00000004606   Transcript: ENSDORT00000004605
Sequence length 359
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6113:6777:13953:1 gene:ENSDORG00000004606 transcript:ENSDORT00000004605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSLKNLQNTIYNPTIPYVGTISEQLKPGSLIVIRGHVPSDADRFQVDLQVGSSVKPRA
DVAFHLNPRFKRSGCIVCNTLTQEKWGWEEIIYDTPFQREKSFEIVIMVLKDKFQVAVNG
KHTLLYAHRISPESIDTLGIYGKVNIHSVGFSFSTDLQNTQASILGLSEINTENXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKILPTNYLSKTLPFKGRLNSPMGFG
RTVVIKGEVNTNAKGFNVDLVAGKSKDIALHLNPRLNVKAFVRNSFLQGAWGEEERNITC
FPFSPGMYFEMIIYCDAKEFKVAVNGVHSVEYRHRLRDLGSVDMLEVDGDVHLLEVRSW
Download sequence
Identical sequences ENSDORP00000004311 ENSDORP00000004311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]