SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004312 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004312
Domain Number 1 Region: 454-676,781-824
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-37
Family FAD-linked reductases, N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 657-771
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.85e-24
Family L-aminoacid/polyamine oxidase 0.00078
Further Details:      
 
Domain Number 3 Region: 273-379
Classification Level Classification E-value
Superfamily Homeodomain-like 8.33e-20
Family SWIRM domain 0.014
Further Details:      
 
Domain Number 4 Region: 374-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000369
Family FAD-linked reductases, N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004312   Gene: ENSDORG00000004602   Transcript: ENSDORT00000004606
Sequence length 825
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6191:37142:85074:1 gene:ENSDORG00000004602 transcript:ENSDORT00000004606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRGRSKKRTATFDLSQDSLPLRSSGRQAKKKATEPVDEDEDGMSEKKYRKCEKAGCT
ATCPVCFASASERCARNGYTSRWYHLSCGEHFCNECFDHYYRXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXVQCTKPECRKWRQLTKEIQLTPQMTKTYRCGLKPNTTAKX
XXXXXXXXXXXXRVSEVSNTWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNR
TAATNSASPATLEPSMVAPSALVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPE
YSRDPTMYLALRNLILALWYTNCKEALTPQKCVPHIIVRGLVRIRCVQEVERILYFMTRK
GLINTGVLTVGVDQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGISMHKLGEKCDLIQEGGRITDPTI
DKRMDFHFNALLDVVSEWRKDKTLLQDVPLGAKIEEIFKAFVKESGIQFSELEGQVLQFH
LSNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIRLRSPQV
QSIDYTGDEVQVATIDGTGYCAQKVLVTVPLAILQKGAIQFNPPLSEKKMKAINSLGAGI
IEKIALQFPYRFWDSKVQGADFFGHVPPSASQRGLFAVYYDMDPEKQQSVLMSVIAGEAV
ASLRTLDDKQVLKQCMATLRELFKEQEVPDPTKYFVTRWSTEPWIQMAYSFVKTFGSGEA
YDIIAEEIQGTIFFAGEATNRHFPQTVTGAYLSGVREASKIAAFI
Download sequence
Identical sequences ENSDORP00000004312 ENSDORP00000004312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]