SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004325 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004325
Domain Number 1 Region: 171-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.64e-26
Family Laminin G-like module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004325
Domain Number - Region: 1-55
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000105
Family Laminin G-like module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004325   Gene: ENSDORG00000004619   Transcript: ENSDORT00000004620
Sequence length 2282
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5458:2205:18810:-1 gene:ENSDORG00000004619 transcript:ENSDORT00000004620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFFGENHLQVPMATALTSINLELQFSTAQPDALLFLAAGQADHLLLQLLSGRLQXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAAASGAPLEAAYGVFVGG
SGGLALPYLRGASRPLRGCLHVASLNGRGLLRPLTPGVQEGCAEEFSAGDDVALGFSGVQ
SLAAFPAWQAQDEGTLELTLTTRSPRAPLAFQAGGRRGDFIYVDIFDGHLRAVVEKAQGT
VLLHNSVPVDDGQPHEVSIRVDAQQLQISVDQYPTRTSNRGPLGYVESGGHLLLGGLDAE
AMGHLQGHRLGLAPPSASLEGCVEDLRVNGRRHGLRDAQWTRHMAAGCKNEEDEYEEDVY
GQYDVLSTLAPDIWPAVELPEPCVPEPGLPPAFANFTRLLTIHPLAVAEGGAAWLEWRHV
QPTLDLTEAEMRRSQVLFRVSRGPRHGQLELDIPGAQARKMFTLLDVVNRKVRFVHDGSE
DASDQLVLEVSVTARGPVPGCLRKGQIYLLPVEISPVDDPPRVLFPQGGLMTILENTQKP
LGPEIVQAYDPDSPCESLTFQILGASTSLPVEHRERPGEPTAEFSCQDLERGDIVYVHRR
GPAQDLSLRVSDGLQASAPATLRVVAVRPTLRVRHSTGLRLVQGSIAAITPANLSVETNA
VVQDVSVLFRLTGDLQGELQKRGPRAKGTEWATQAFHQRDVDQHRVRYVSTDPARRADMA
EDVALEVQVGQETLDNLSFPVSIQRAAVWMRRLTPLRTHHARPEPLTAAHLEAALEEGPS
PSAFRYHLVQPPKKGNLQLRGARLAEGQSFTQDDIHAGRVSYVATTRVSQATEDAFRFRI
TAPPHFSPLYTFPVHVGGDPDAPVLTNTVLPVPEGGHATLTPQHLFIKSPHGDSYVYEVI
ESPRHGRLAWQPPRDAAAPVTTFTNDDLRRGLLQYRHDHSETTEDDVPFVATRQGESSSG
DAAWEEVRGVFRVAIRPVNDHAPRQVVSRVFRVARGGRRLLTTDDVAFSDADSDASDAQL
VLTRKDLLFGSIVAVEDPARPVYRFTQEDLRAGRILFVHSGADHGWLQLQVSDGQHQTTA
MLEVQASEAYLRVANGSGLVVPQGGQGTVDAAAFHLETNLDIRSGEEVHYRVTAGPRWGQ
LLRAGQPATAFSQQDLLDGKILYSHNGSLAPRDSVGLAVEAGPVRTDTILQVTVVLDGTP
APPQLLRHQKIYAVQGEAARIGREQLEVSQEAVPPADIVFSVKMPPAAGHLVSQGPDAAD
PRSLGPAGSFSQEDVNAGRVFYVHTRPEAGEDAFSLDVTSGLGAPLEGVLLELEVLPRVL
PLEAQNFSVPEGGARTLAPPLIRVPGPRLSTLPGLRLHVLDPPQHGALRKEGQRQDQTLL
SFSWREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXMWEGATVPIPPEALRGTDSDSGPDDLVYTIEQPSNGRVALRAAPGDAVQHFTQAQ
LDGGLVLFSHTGALDGGFRFALSDGAHASPGHFFRVTAQKQVLLSLDGSRTLTVCPESVQ
PLSSQSLRASSSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYAGHVL
YEHQASPEPFWEAQDTIELALSSPPAPDVAVTLAVTVTFQAACPQRPSRLWRNKGLWVPE
GQRAAITPAALDAANFLASVPASQRPQHDVLFQLTQFPTRGQLWVSGEPLHAGSPHFLQS
QLAVGQLVYAHGGGGTQPDSFRFRAQLRGPAGVSATAPHTSEAFAITVRDVNERPPQPQA
SAPLRLTRGSRAPISRAQLSVVDPDSAPEEIEYEVQRAPHNGFLSLAGGSPGPVDRFTQA
DVDGGRLAFVANGSSMAGVLELSVSDGASPPLPMSLAVEVLPSTLEVQTRAPLEVPQASG
RSPLSQQQLQVFSDRPEPDVAYRVTQGPRHGQLLVGGRPASAFSQLQVDRGEVIFTFTNF
SSPHDRFGVLALARGANATATVNVTVRALLRVWPGGPWPQGATLRLDRSVLDAGELANVT
GTVPHFRLLQGPRHGRLVPTSQARTESRNSQLVEGFTQRDLEAGRLGLEVDRPEGPPGPV
ADRLTLELWAPGVPPAVASVDFITEPYDAARSYGVALLRVPDVVRTGKPEGSSPTGQPGP
AAASPGPTAARGGFLGFLEANMFSIIIPVCLVLLLLALILPLLFYLRKRNKTGKHHVQVL
TAKPRNGFAGDTETFRKVEPGQAILLTAVPGQGPPPGGQPDPELLQFCRTPNSALRNGQY
WV
Download sequence
Identical sequences ENSDORP00000004325 ENSDORP00000004325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]