SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004362 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004362
Domain Number 1 Region: 529-626
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.94e-40
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 383-438
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.41e-22
Family Eukaryotic proteases 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004362
Domain Number - Region: 128-154
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000589
Family Pan module (APPLE domain) 0.041
Further Details:      
 
Domain Number - Region: 297-345
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00883
Family Pan module (APPLE domain) 0.023
Further Details:      
 
Domain Number - Region: 223-260
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0147
Family Anti-platelet protein 0.09
Further Details:      
 
Domain Number - Region: 42-65
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0255
Family Pan module (APPLE domain) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004362   Gene: ENSDORG00000004654   Transcript: ENSDORT00000004657
Sequence length 636
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1660:59532:78308:1 gene:ENSDORG00000004654 transcript:ENSDORT00000004657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFSQAAHFLCLFSTVSCGCLTQLYKNTFFRGGDVTALYSPDAHHCQMVCTFHPRCLLF
SFLPSSSTKDPKKRFGCFLKDSVTGDLPRMRRTNAISGYSLKQCGYQISACHRNIYENID
MRGSNFNISKVTSPEECQKLCTNNILCHFFTYATQTFPNAEYRNNCLLKHSPSGTPMSIK
VLDSVVSGFSLKPCALSEIGCHMDLFQHRAFSDMDVARVVSPDAFVCRTICTYHPNCLFF
TFYTNAWSVESQRNACYLKTSKSGTPSPSIQENTISGHSLATCRKTLPEPCHSKIYSGVD
FRGDELNVTFEEEATACQDTCTKIIRCQFFTFSSLPEDCKGEKCKCSLRFSLDGNPARIT
SGPHWSSGYSLRLCKTGDGSVCTTKTNARIVGGTNSSLGEWPWQVSLQVKLTSRNHVCGG
SIIGEQWVLTAAHCFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIQNTLQKASLP
LVTNEECQKRYRDYTITKQMICAGYKEGGKDACKGDSGGPLVCKHNGVWQLVGITSWGEG
CARKEQPGVYTKVAEYVDWILEKTQNGSGDASMTSP
Download sequence
Identical sequences ENSDORP00000004362 ENSDORP00000004362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]