SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004396 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004396
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.75e-22
Family Pyk2-associated protein beta ARF-GAP domain 0.0032
Further Details:      
 
Domain Number 2 Region: 26-59,112-210
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.27e-20
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004396   Gene: ENSDORG00000004699   Transcript: ENSDORT00000004699
Sequence length 750
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4438:83178:92753:-1 gene:ENSDORG00000004699 transcript:ENSDORT00000004699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASNGANSIWEH
SLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLPCRDDDGVTAKDLSKQLH
SSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQTLQAELLVVYGADPGSPDV
NGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPDHKNGHYIIPQMADRSRQK
CMSQSLDLSELAKAAKKKLQGLSNRLFEELAMDVYDEVDRRENDAVWLATQNHSTLVTER
SAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSLSSPTENLEL
SARNQSDLDDQHDYDSVASDEDTDQEPPRSANATRNNRARSMDSSDLSDGAVTLQEYLEL
KKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPSGPVPTPTLPSDRAE
HSAMGTSGSSHRRDRQAFSMYEPGSALKPFGGAPGDELSTRLQPFHSTELEDDAMYSVHV
PASLYRIRKGVSASAVPFTPTSPLLSSQEGSRHMSKLSRHGSGADSDYENTPSGDPLLGL
EGKRFLDLGKEDDIHELESLDGDLDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSF
VPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQ
LLTQQVIQCAYDIAKAAKQLVTITTREKKQ
Download sequence
Identical sequences ENSDORP00000004396 ENSDORP00000004396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]