SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004410 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004410
Domain Number 1 Region: 917-965,996-1037
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000163
Family Fibronectin type III 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004410
Domain Number - Region: 505-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0289
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004410   Gene: ENSDORG00000004713   Transcript: ENSDORT00000004714
Sequence length 1194
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5877:361041:889489:-1 gene:ENSDORG00000004713 transcript:ENSDORT00000004714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTAADISLVHWRQQWLENGTLYFHVSMSSSGQLARATAPTLQEPSEIVEEQMHILHIS
VMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXAAEATQETVESLMQKFKESFRANTPIEIGQLQPAPRSVSAGKRKRRSKS
RGGISFGRTKGTSGSEADDETQLTFYTEQYRSRRRSKGLLKSPVNKTALTLIAVSSCILA
MVCGTQMSCPLTVKVTLHVPEHFIADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXCSCHEGFAPDPXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSTFSLGQGLWLPVSKSFVVPPVELSINPLASCKTDVLVTEDPADV
REEAMLSTYFETINDLLSSFGPVRDCSRNNGGCTRNFKCVSDRQVDSSGCVCPEELRPMK
DGSGCYDHSKGIDCSDGFNGGCEQLCLQQTLPLSYDASSSTIFMFCGCVEEYKLAPDGKS
CLMLSDVCEGPKCLKPDSKFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIRYDEAMGYPMVQRWRVRSNLYRVKLS
TITLSAGFTNVLKILTKESSRDELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQL
WLQYQKETTELGSKKELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHL
CRRPGKEQLSPTPVLLEINRVIPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRC
DLSAFDASGLPNCSPLPQPVLRLSPSVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVD
EYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVNIYSVIFKCLEPDGLYKFTL
YAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQTAYNTLMEVS
ASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSPYIQSR
VDTVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYYLTLSNVSPF
Download sequence
Identical sequences ENSDORP00000004410 ENSDORP00000004410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]