SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004426 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004426
Domain Number 1 Region: 1-43,75-225,287-350
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.06e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 
Domain Number 2 Region: 315-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000149
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004426   Gene: ENSDORG00000004731   Transcript: ENSDORT00000004731
Sequence length 472
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_970:8019:27348:1 gene:ENSDORG00000004731 transcript:ENSDORT00000004731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKVAVIGAGVSGLISLKCCVEEGLEPTCFERTEDIGGLWRFKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTVLSVKKLPDFP
SSGQWEVVTQSHGQERREVFDAVMVCSGHHIIPNIPLDSFPGIEKFKGQYFHSRQYKHPV
GFEGKRILVIGIGNSAADIAAELSKKAAQVFISTRHGSWVMSRISEDGYPWDMVFHTRFS
SMLRNVLPRTVVKWMTEQQLNQWFNHENYGLEPQNKYLMKEPILNDDLPSRILYGAIKVK
PRIKALTETAAIFEDDTVEEDIDVIVFATGYTFSFPFLEDSLVSVENNMVSLYKFMFPPQ
LEKPTLACIGLIQPLGSIFPTVELQARWVTRVFKGLCSLPSKNTMMADIINRNEKRTDLF
GKSQSQILQTNYVDYLDELALEIGAKPDIASLLFKDPKLAVKLYFGPCNSYQ
Download sequence
Identical sequences ENSDORP00000004426 ENSDORP00000004426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]