SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004455 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004455
Domain Number 1 Region: 248-468
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.27e-40
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 558-610
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000471
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 842-899
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 903-959
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 1017-1068
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004455
Domain Number - Region: 970-1017
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00445
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004455   Gene: ENSDORG00000004761   Transcript: ENSDORT00000004762
Sequence length 1116
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6756:89067:251838:-1 gene:ENSDORG00000004761 transcript:ENSDORT00000004762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEILWKTLTWILSLIMASSEFHNDHTLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFT
VKNAKHSRRRRSMDPIDPEQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDG
PQWKHDFLDNCHYTGYLQDQRSTTKVALSNCVGLHGIIATEDEEYFIEPLKNTTEDSKHF
NYENGHPHVIYKKSTLQQRHLYDHSHCGLSDFTSSGKPWWLNDTSSAFPSLLPINDTHTH
HRLKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMNIXXXXXXXXXXXXXXXXXX
XXXXXXXXXXPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHHDNAVLITXX
XXXXXXXXXXXXXXLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNS
CGTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVA
PGQVYDADEQCRFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGSIEK
GWCYQGDCVPFGTWPQSVDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLG
ERKRYRSCNTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVPCALNCLAEGYN
FYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSDAREDRCRVCGGDGSTCDAIE
GFFNDSLPRGGYMEVVQIPRGSVHIEVREVAVSKNYIALKSEGDDYYINGAWTIDWPRKF
DVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNEV
GFMWHHQPWSECSVTCVGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRDCNTEPCP
PEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPMEKESCNNQSCP
PQXXXXXXXXCTPKCGPGFKHRIVLCKSSDLSKTFPAAQCPDESKPPVRIRCSLGRCPPP
RWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASSDCPDTVRPPSMQQCESKCDSTPISST
EECKDVNKVTYCPLVLKFKFCSRAYFRQMCCTCQGH
Download sequence
Identical sequences ENSDORP00000004455 ENSDORP00000004455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]