SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004457 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004457
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000000022
Family Predicted metal-dependent hydrolase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004457   Gene: ENSDORG00000004765   Transcript: ENSDORT00000004764
Sequence length 166
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5858:924:7554:1 gene:ENSDORG00000004765 transcript:ENSDORT00000004764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVIRNLQRVIPIRRTPLRRKMEIVRSILGVRKFDLGLICVDNKNIQHINRIYRKKDIP
TDVLSFPFHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXMYLKKNVLEELSRHTGARLQPLSRCLYWNS
Download sequence
Identical sequences ENSDORP00000004457 ENSDORP00000004457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]