SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004491 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004491
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.23e-41
Family Eukaryotic proteases 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004491   Gene: ENSDORG00000004802   Transcript: ENSDORT00000004802
Sequence length 204
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_53864:549:3693:1 gene:ENSDORG00000004802 transcript:ENSDORT00000004802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGYSYERDTTLRDPVAMAKRWPWMVSVRANGTHICAGTLIASQWVLTVAYCLTHSNVNYT
VRVGSPWLDEVTEKTADVQVLKVLRHRRYRSERYWSWVGRSHNIGLLKLQHTLKYSDHVW
PICLPGLEFEVEDKAVCAVTGWGYPRAEGVWPQFRTIQEREVVILNSRKCEDFYHRSARI
PSLIRIITPQMICVSDINREDFCY
Download sequence
Identical sequences ENSDORP00000004491 ENSDORP00000004491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]