SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004508 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004508
Domain Number 1 Region: 549-666
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-19
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 54-114
Classification Level Classification E-value
Superfamily Chromo domain-like 3.56e-17
Family Chromo domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004508   Gene: ENSDORG00000004819   Transcript: ENSDORT00000004819
Sequence length 853
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6298:40626:68021:1 gene:ENSDORG00000004819 transcript:ENSDORT00000004819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEAPSVEGASTAAAPMSGPDSSGEWPGVEGGDGGAGEEDAATKEAEAVGESEEDGEDV
FEVEKILDMKTEAGKILYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFKKEVSENKAKAF
KKDIQRLSLNSDIFEANSDSDQQSETKEDSSPRRKKKKLRSKEDKSPDGLKKRKTKTGKL
RVKSELGSAAESSVLDLRTKKRTLEAKEELKDSKKTRKDEIKETKELRKGKKADVRDVKN
KVKEDPKDNRKTKKEKCVDSQLESESSTLTEDDKEEFPPDNREEKQTKSTKDRVEQDANQ
DGVFEKQLNDSVSADEDDNGKGKRKKKKLKKAEEVKEIIMLENKKTFAEKKTVPKKQRNQ
GIKPSDIELDKLMPYLSAQTQKTSRSAGEDKILQPSDSVEEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIKEIKSAFDLLKKTTEEKNDVPEINQKKEVSLDCKTTEDCKMKEG
KYSPNEKKNTRDETDTWAYIAAEGDEEVLDSVCQMDGNSDGRHQILSLGMDLQLEWMKLE
DFQKHLDGEDETFTTVNVIPNNLLRDAVKNGDYITVKVALNSDEDYDLDQEDSSGMTLVM
LAAAGGQDDLLRLLITKGAKVNGQQKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSG
ETALMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKSHLETLS
RVAEETIKDYFEARLALLEPVFPIACHRLCEGPDFSTDFNYNPPQNIPEGSGILLFIFHA
NFLGKEVIARLCGPCSVQAVVLNNIFQLPVFLDSHFVYSFSPIAGPNKLFIRLTEAPFTK
VKLLIGAYRVQLQ
Download sequence
Identical sequences ENSDORP00000004508 ENSDORP00000004508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]