SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004552 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004552
Domain Number 1 Region: 442-536
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000191
Family I set domains 0.036
Further Details:      
 
Domain Number 2 Region: 241-327
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000209
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 739-817
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000285
Family MAM domain 0.0052
Further Details:      
 
Domain Number 4 Region: 156-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000125
Family I set domains 0.062
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004552
Domain Number - Region: 48-70
Classification Level Classification E-value
Superfamily Immunoglobulin 0.022
Family I set domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004552   Gene: ENSDORG00000004863   Transcript: ENSDORT00000004865
Sequence length 948
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3332:72225:276785:-1 gene:ENSDORG00000004863 transcript:ENSDORT00000004865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVYGLVWLLTVLLEGISGQGVYAPPTVRIVHSGLACNIEEERYSERVYTIREGETLEL
TCLVTGHPRPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLRCVANSNPPVRYSWRRGQEVLLQ
GSDKGVEIYEPFFTQGETKILKLKNLRPQDYANYSCIASVRNVCNIPDKMVSFRLSNKTA
SPSIKLLVDDPIVVNPGEAITLVCVTTGGEPAPSLTWVRSFGTLPEKIVLNGGTLTIPAI
TSDDAGTYSCLANNNVGNPAKKSTNIIVRAKEGRFWITSDPYHXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXPPNLTVPQEKSPLVTREGDTIELQCQVTGKPKPIILWSRAD
KEVAMPDGSMQMESYDGTLRIVNVSREMSGMYRCQTSQYNGFNVKPREALVQLIVQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMN
PDAVDRIVAYRLGIRQAGQRWEQEIKINGIQTRLITYLTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXEFHCGFEDGNICLFTQDDTDNFDWTKQSTATRNTKYTPNTGP
NADRSGSKEGFYMYIETSRPRLATRKARLLSPVFSIAPKSYGTNTAYCFSXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSVDGAVGILVHLWLFPVIVLISILSPRR
Download sequence
Identical sequences ENSDORP00000004552 ENSDORP00000004552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]