SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004586 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004586
Domain Number 1 Region: 120-232
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000513
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004586   Gene: ENSDORG00000004901   Transcript: ENSDORT00000004901
Sequence length 325
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_89351:727:1758:1 gene:ENSDORG00000004901 transcript:ENSDORT00000004901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSGASANSESKPLLKPTPRSLRGAPQLRPSLGNTTTLGRYWGHAAAVSRESSFQGSLM
LPEASFARRRETLRELLGLQRMSVPSRWLSVGHAKEPSPRGSGRLNGSSGGGLLLEPREH
AWILAAAEGRFEVLRELLEAEPRLLLRGDPITGYTLLHWLAKHGYHEEMILVYDFAKRQG
LPLDVSATGSGGFTPLHLAALQGHDMVIKVLVGALGADPTRRDHSGHRACHYLRPDAPQK
LRELSGAEDWETEKRSVITTPNNNSNTTSGWMLKRTLSMPAAGVADIETGRGAAAAEAKK
KNATGSQETYMNRFLRHLFPFFQDR
Download sequence
Identical sequences ENSDORP00000004586 ENSDORP00000004586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]