SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004589 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004589
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-27
Family C-type lectin domain 0.00000245
Further Details:      
 
Domain Number 2 Region: 200-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.09e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 325-392
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000106
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 256-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000111
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 447-520
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000114
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 380-446
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 7 Region: 633-698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000612
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 504-569
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000104
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 9 Region: 579-644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 10 Region: 160-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000303
Family EGF-type module 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004589   Gene: ENSDORG00000004904   Transcript: ENSDORT00000004904
Sequence length 766
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2085:107634:139513:-1 gene:ENSDORG00000004904 transcript:ENSDORT00000004904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCLKVIWTLRLQSVVLGAAQLLWFSALISELTNQKEVAAWTYNYSVKAYSWNYSRAFC
QRHFTDLVAIQNKNEIAYLNDFVPFFSSYYWIGIRKINNKWTWVGTRKTLTKEAENWADN
EPNNKRNNQDCVEMYIKSELAPGRWNDEPCWRRKRALCYTASCQDTSCNNQGECIETIGN
YTCSCYPGFYGPECEYVRECGEFDLPPHVSMNCSHPLGNFSFNSQCTFHCAEGYELNGPS
KLECLASGIWTNNEPPQCEAVRCPALEAPGEGTMDCVHPLATFAYGSSCKFECRPGYRVR
GLDTLRCVGSGQWTAPLPACEAVACEPLESPTHGRVECSPPSSTFPYNTSCSFHCAEGFV
LQGASAAQCADSGRWTAPAPACQAVQCQEFPVPRRAQMNCSHPFGPFQHQSVCSFSCREG
SLLAGARVVRCMATGRWSAPPPECRAISCTPLLSPQNGTVTCVQPLGGSSYKSTCQFNCD
EGFSLSGPERLDCTPSGHWTGSPPTCKVIQCPELSAPEQGHMDCSHAHGPFSIGSFCSFS
CGKGFVLEGSFGVGCTMAGRWSTAPPTCKGAASRPTKVVRCPALTIPGQGTMSCPGAFGL
NTTCYFGCKAGFTLIGDSALRCRPSGQWTAATPACRAIKCPELHVNQSIVMNCSNPWGNF
SFGSTCTFHCSEGQLLNGSAKAACQENGAWSAIMPTCQAASLTIQEVLAYLGGAVASTSA
LAMSGVLLALLRKRLRKKDDGECPLNPHSHLGTYGVFTNAAFEPNP
Download sequence
Identical sequences ENSDORP00000004589 ENSDORP00000004589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]