SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004591 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004591
Domain Number 1 Region: 79-192
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-20
Family C-type lectin domain 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004591   Gene: ENSDORG00000004906   Transcript: ENSDORT00000004906
Sequence length 377
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2085:162108:178249:-1 gene:ENSDORG00000004906 transcript:ENSDORT00000004906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARCRGARGAPEAMILAWTRQGAGRGSRALSGLWLWTALCCXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXAIQNKAEIEYLEGTLPSRYYWIGIRKIGQTWTWVGTNKSLTEE
AENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKTALCYTASCGSQSCGGRGE
CVETINNHTCNCEPGYYGPECQLVVECEPLSAQTGTMDCHLGNFSFRSQCFLCTEGTDII
GAEETSCGPGHCSSLEPTCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXTGRTFSVASEGGYNPLFIPVAVMVTAFSGLAFIVWLA
RRLRRXXXXXXXMDDPY
Download sequence
Identical sequences ENSDORP00000004591 ENSDORP00000004591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]