SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004620 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004620
Domain Number 1 Region: 131-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000956
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004620
Domain Number - Region: 497-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004620   Gene: ENSDORG00000004936   Transcript: ENSDORT00000004936
Sequence length 538
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_164:7994:37227:-1 gene:ENSDORG00000004936 transcript:ENSDORT00000004936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGMWVWRALAEVFLLSAFLVCLSLPGSRGQIPHSLESNTVNGSLARSRQVRSVDVAPM
PVDCELSSWSSWTACDPCQKKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXRCINRRLLCNGDNDCGDQSDEANCKRIYKKCQREMDQYWAIGTLASGINL
FTNSLEGPVLDHRYYAGGCSPHYILNTRFRKPYNVDSYTPQTQGKNEFTFMEYESYSDFE
HNVTKHVTSKSSFSFGLKIPKIFEFGIDEASNAGKHYISRIKRFSHTKSKFLHARSDLEV
AHYKLKPRSLMLHYEFLQRVKQLPLEYSYGEYRDLLRDFGTHYITEAVLGGIYEYTLIMN
KEAMERADYSLNNIWACAKSDFQIGGAIKNVYVKLGVSEQLCGDILNEIKDRNKRKTMIE
DLVVLVRGGASEHITTLAYKELPTAELMQEWGDAVQYNPAIIKVKAEPLYELVTATDFAY
SSTVRQNMKRALEEFQREASACLCAPCQGNGVPVLKGSRCDCICPVGFQGLACELTYR
Download sequence
Identical sequences ENSDORP00000004620 ENSDORP00000004620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]