SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004621 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004621
Domain Number 1 Region: 24-121,203-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.42e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000217
Further Details:      
 
Domain Number 2 Region: 339-371
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000158
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004621   Gene: ENSDORG00000004937   Transcript: ENSDORT00000004937
Sequence length 372
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6489:6611:29924:1 gene:ENSDORG00000004937 transcript:ENSDORT00000004937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYQESQLQKPIEMNSAKDLPRTYDYDLIIIGGGSGGLAAAKXXXXXXXXXXXXXXXXXXX
XXXXXXLGGTCVNVGCIPKKLMHQAALLGQALKDSGTYGWKVEDTVQHDWEKMTEAVQNH
IGSLNWGYRVALREKKVTYENAYGKFVGPHRIKANNRGKEKIYTAERFLIATEKARYGIP
DDYCISGLDVAVMVPSILLRGFDQDMANKTGEHTEEPGIRFVFVPTQIEQIEAGTPGRLR
VIAKSTNSEETIEGEYNTVLLAIGRDSCTRNIGLETVGVKINEKTGKIPVTDEEQTNVPY
IYAIGDILEGKLELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGSCGLSEE
KAIEKFGEENIE
Download sequence
Identical sequences ENSDORP00000004621 ENSDORP00000004621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]