SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004636 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004636
Domain Number 1 Region: 35-149
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-33
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 246-372
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.57e-27
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004636   Gene: ENSDORG00000004951   Transcript: ENSDORT00000004953
Sequence length 502
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_132:1783:10098:1 gene:ENSDORG00000004951 transcript:ENSDORT00000004953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGLVGGRPGSRGAPVVQQNIPSTLLQEHENQQIFEMLGRKCWXXXXXXVQLYLALPPG
AGHWPLMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYAQLIYFTPTPFFHTFAG
DDCQVGLNFADECEAQAFQALVQEKIQKRNQRQSGDRRQLPPPPAPANEERRGGLPPLPP
HPGGDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGG
IEAVRQEMRRQEPLPPPPPPCRGGNQAPRPPMVGGNKGRTGPLPPVPMGNVPPPPTPRGP
PPPGRGGPPPPPPPATGRSGPPPPPPPAVGGASMPPPPPPPPPPSIGSEPTLLSPPPTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEGEDQAADEDEDDEWDD
Download sequence
Identical sequences ENSDORP00000004636 ENSDORP00000004636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]