SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004659 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004659
Domain Number 1 Region: 361-425
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.29e-18
Family LIM domain 0.013
Further Details:      
 
Domain Number 2 Region: 302-365
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.18e-18
Family LIM domain 0.028
Further Details:      
 
Domain Number 3 Region: 273-300
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000804
Family LIM domain 0.005
Further Details:      
 
Domain Number 4 Region: 421-446
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000416
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004659   Gene: ENSDORG00000004979   Transcript: ENSDORT00000004978
Sequence length 451
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6363:621:19928:-1 gene:ENSDORG00000004979 transcript:ENSDORT00000004978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAQPAQGKPQKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ
DPDEEHQKKSSQVKTEAPASTSAPXXXXXXLVNPSPTSRPPWAVDPAFAERYAPDKTSTV
LTRHRQPATPTPLQNRTSIVQAAAAGGGTNGKTPVCHQCHKVIRGRYLVALGHAYHPEEF
VCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFT
CAACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFSWHDTCF
VCAICQINLEGKTFYSKKDKPLCKSHAFSHV
Download sequence
Identical sequences ENSDORP00000004659 ENSDORP00000004659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]