SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004663 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004663
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-39
Family Dual specificity phosphatase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004663   Gene: ENSDORG00000004986   Transcript: ENSDORT00000004985
Sequence length 188
Comment pep:novel scaffold:dipOrd1:scaffold_187544:358:924:1 gene:ENSDORG00000004986 transcript:ENSDORT00000004985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAPGASLLPCQQPTISGLSQITSSLYISNAAAANNKLLLTSNQITTVINVSVEVANTF
HENIQYTHVPVADMPSSRLCDFFDPIADHIHEVELKQGRTLLHCAAGVSRSATLCLAYLM
KYHAMSLLDAHTWTRSCRPIIRPNSGFWEQLIHYEFKLFGKNTMHMVSSPVGMIPDIYEK
EVRLMIPL
Download sequence
Identical sequences ENSDORP00000004663 ENSDORP00000004663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]