SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004682 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004682
Domain Number 1 Region: 907-976
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-19
Family TB module/8-cys domain 0.00073
Further Details:      
 
Domain Number 2 Region: 2004-2074
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 3 Region: 2292-2361
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-18
Family TB module/8-cys domain 0.00049
Further Details:      
 
Domain Number 4 Region: 491-615
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.51e-17
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 5 Region: 2082-2216
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 669-811
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 124-209
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 8 Region: 1644-1737
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.36e-16
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 9 Region: 802-886
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.15e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 10 Region: 276-336
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.93e-16
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 11 Region: 1098-1238
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000126
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 12 Region: 422-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 1481-1554
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000183
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 14 Region: 607-679
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000129
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 15 Region: 1273-1403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 16 Region: 2445-2572
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000033
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 17 Region: 2533-2646
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 1560-1615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000963
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 19 Region: 2405-2463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000347
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 20 Region: 2360-2409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000037
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 21 Region: 984-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000283
Family EGF-type module 0.004
Further Details:      
 
Domain Number 22 Region: 1965-2018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000163
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 23 Region: 1882-1939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000276
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 24 Region: 1723-1773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000503
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 25 Region: 1022-1060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000641
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 26 Region: 2198-2248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000345
Family EGF-type module 0.019
Further Details:      
 
Domain Number 27 Region: 1758-1808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000592
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 28 Region: 1604-1645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000896
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 29 Region: 1444-1488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000913
Family EGF-type module 0.00076
Further Details:      
 
Domain Number 30 Region: 1846-1890
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 31 Region: 1926-1964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000203
Family EGF-type module 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004682
Domain Number - Region: 95-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 2739-2785
Classification Level Classification E-value
Superfamily Cadherin-like 0.0345
Family Cadherin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004682   Gene: ENSDORG00000005003   Transcript: ENSDORT00000005005
Sequence length 2825
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3272:8533:219076:-1 gene:ENSDORG00000005003 transcript:ENSDORT00000005005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQISPTCGAKS
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCENGCQNGGRCIGPNRCACVYGFTGP
QCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGF
IPNIRTGACQDVDECQAIPGLCQGGNCINTVGSFECRCPAGHKQSETTQKCEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRTGTCFSGLVNGRCAQELPGRMTK
MQCCCEPGRCWGVGALPEACPVRGSEEHRRLCMEGLPMGGIPGSAVSRPGGSGGNGFIPH
GNGYGPGGPSFLPVPGGNGFSPGVGGAGVGAGGQGPIITGLXXXXXXXXXXXXXXXXXXN
GRCIRTVSSYRCECNMGYKQDTNGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQRT
PTKQACIDIDECIQNGVLCRNGRCVNTDGSFQCICNAGFELATDGKNCADHDECTTTNMC
LNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQTPGICMNGHCINNEGSFRCDCPPG
LAVGVDGRVCVDTHMRSTCYGGIKKGACVRPFPGAVTKSECCCANPDYGFGEPCQPCPAK
TSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASGRN
CIDIDECLVNRLLCDNGLCRNTPGSYSCTCPLGYVFRMETETCEDINECESNPCVNGACR
NNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLGAA
WGSPCERCELDAACSRGFVRIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGLT
LDGTGRVCLDVRMEQCYLKWDEDECVHPVPGKFRMDACCCAVGAAWGAECEECPKPGTKE
YETLCPRGPGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCHSGFALD
MEERNCTDIDECRISPDLCGSGVCVNTPGSFECECFEGYETGFMMMKNCMXXXXXXXXXX
XXXXXXXXXTEGSFRCDCPLGHELSLSREDCVDINECSLSDNLCRNGKCVNMIGTYQCSC
NSGYQATPDRQGCTDIDECLIMNGGCDTLCTNSEGSYECSCIAGYALMPDGRSCADIDEC
ENNPDTCDGGQCTNIPGEYRCLCYDGFMASMDMKTCIXXXXXXXXXXXXXXXXXXXXXXX
XXXHCQLGSVKKGSTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKCID
LDECSNGTHQCSINAQCVNTPGSYRCTCSQGFTGDGFTCSDTDECAENINLCENGQCLNV
PGAYRCECEMGFTPAADSRSCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPRGD
GSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITIIL
EDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTC
YNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTACENELPFNVTKRMCCCTYNV
GKAWNKPCEPCPTPGTAFQAICGNIPGFTFDIXXXXXXXIDECKEIPGICANGVCINQIG
SFRCECPTGFSYNDLLLVCEDIDECSNGDNVCQRNADCINSPGSYRCECATGFKLSPNGA
CVDRNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDECERHPCGNGTCK
NTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGYELTP
DGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSENCXXINECEEDPNICLF
GSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCS
KMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVSSLHDTREDVNECLESPGICSNGQCIN
TDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCANVIGSFECNCNEGFEPGPMM
NCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCESRG
MMCKNLIGTFMCTCPPGMARRPDGEGCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHHCELCPLPG
TAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNGQCINTMGSFRCFCEVGYTTDISGTSC
VDLDECSQSPKPCNFICKNSEGSYQCSCPRGYVLQEDAKTCKDLDECQTKQHNCQFLCVN
TLGGFTCKCPPGFTQHHTACIDNNEXXVAFQPSLCGKKGICQNPGSFSCECQRGFSPDAT
GLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYVQHYQWNQCVDENECSNPSACGSAS
CYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGYYRV
GQGHCVSGMGFNKGQYLSLDAEVDEENALSPEACYECKINGYSKKDGRQKRSIQHAEPTA
AGEISLESVDIDNPVNMKFNLSDLGSKEHILELMPAIEPLNNHIRYVISQGNHDGIFRLH
QRNGLSYLHTAKKKLPPGVYTLEVSSVPLHRKKELKNVEGSSEDDYLLLGELGEALRMRL
HIQLY
Download sequence
Identical sequences ENSDORP00000004682 ENSDORP00000004682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]