SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004721 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004721
Domain Number 1 Region: 185-297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-29
Family Spermadhesin, CUB domain 0.000031
Further Details:      
 
Domain Number 2 Region: 22-74
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-16
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004721
Domain Number - Region: 300-338
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00559
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number - Region: 155-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004721   Gene: ENSDORG00000005046   Transcript: ENSDORT00000005046
Sequence length 339
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4391:255:8726:-1 gene:ENSDORG00000005046 transcript:ENSDORT00000005046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRALLWVSALLGGAGGSSPQKLFGTVTSPRYPKPYPNNVETTTVIEVPRGYRVKLVFRMF
DVEPSEACFYDYVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXDECTAPHPLDGRGPPCQHLCHNYIGYFCSCRASYELQKDG
SCRAECSRELHTEPSGFISSLEYPRPYPPDLRCNYSIRVDRGFSLHLKFLEPFDIDDHQQ
VHCPYDQLQIYASGKRLGEFCGKQRPPDLDVSSNAVDVVFFTDESGDSRGWKLRYTTQTV
KCPQPKALDEFTIIEKLKSLYEYRDYFVATCKQGYQLVK
Download sequence
Identical sequences ENSDORP00000004721 ENSDORP00000004721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]