SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004727 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004727
Domain Number 1 Region: 303-487
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-69
Family SPRY domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-18
Family B-box zinc-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 2.36e-18
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004727   Gene: ENSDORG00000005051   Transcript: ENSDORT00000005052
Sequence length 508
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6626:39763:58281:-1 gene:ENSDORG00000005051 transcript:ENSDORT00000005052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGAAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMLICVVCDR
SREHRGHSVLPLEEAVDGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEYEQLYHSLQEHEYRLLARLEELDLAIYSINGAITQFSCISHLSSLIAQLEEKQQQ
PTXXXXXDIGDTLSRAERIRPEPWITPPDLQEKHFAQKCLFLTESLKQFTEKMQSDMEKI
QELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPC
FIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMT
ALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAA
PLIICPMSGIDGFSGHVGNHGHSMETSP
Download sequence
Identical sequences ENSDORP00000004727 ENSDORP00000004727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]