SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004740 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004740
Domain Number 1 Region: 1222-1324
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-44
Family Endostatin 0.00000251
Further Details:      
 
Domain Number 2 Region: 40-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-33
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 3 Region: 813-972
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-24
Family Endostatin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004740   Gene: ENSDORG00000005064   Transcript: ENSDORT00000005066
Sequence length 1331
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6606:13341:102927:1 gene:ENSDORG00000005064 transcript:ENSDORT00000005066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRNAQCWRLLWPLLSVSALLSTLTRTRASAELPSQGHLDLTELIGVPLPSAVSFVTG
YGGFPAYSFGPGANVGRPARTLIPPTFFRDFAISAAVKPSSAQGGVLFAITDAFQKVIYL
GLRLSGVEDGRQRILLYYTEPGSHVSHEAAAFSVPVMTSKWNRFSLIVQDEEVTLLMDCE
EHSHVLFQRSSQSLTFEPSAGVFVGNAGATGLERFTGSIQQLIIYTDPRTEELCEAHESS
ASGEASGSQEMDTVAEILEAITYTQAPXXXXXXXXXXXXXXXXXXXXXTELSGEPMPEGT
PETNMSIITPHSIPEQGSGEILNDTLEGVHPVDGDPIPDMGSGSGAFLDATEEQGSTATT
EKEAMVSVTNAQAAEVSNVSTGILAMSTQNPGEVASPXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVPGGEVGLTTAATSPKVPLSTVEEEEASGDPT
DGPTAFTLPPTPGQTFTSAPVDGDMATASTEKTEEEGSGGMSPPGPLLPTPTVAPERQVT
MAWSEGSGLGWGLDAGSGSGDLVGSEDLLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGPKGQPGPDGDSGKPGMKGEKGARGPNGSVGEKGDPGSRGLPGPPGKN
GQAGTPGVMGPPGPPGPPGPPGPGCTTGLEDIEGSGSIRLLNEPRLFGPTASSGLKGEKG
DQGPKGERGMDGTSTVGPPGPRGPPGSIEVLHSSLINITNGSMNFSDIPELMGPPGPDGL
PGLPGFPGPRGPKGDTGVPGFPGLKGEQGEKGEPGAILTGDIPLERVKGQKGEPGMHGAP
GQMGPKGPPGHKGEFGLPGRPGRPGLNGLKGAKGDSGVIRPGPPGPPGPPGPPGPPGAVV
NIKGAVFPVPARPHCKTPVDATHPGDPELVTFHGVKGEKGSWGIPGSKGEKGDQGAQGPP
GPPVDPTYLRHFLNSMREENGDRGIRGDPNGNFFVSGPPGLPGNPGLIGQKGEAVVGPQG
PPGTPGLPGPPGFGRPGAPGPPGPPGPPGPPAILGSAVALPGPPGPPGXXXXXXXXXXIS
AFANMDDMLQTAHLVIEGTFIYLRDSSEVFVRVRDGWKKLQLGELIRVPVNSLPPPALSS
SPYHPPPPVSPISGNYERPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGQVLFNNWDSIFSGNGGQFNTHIPIYSFDGRDVMTDPS
WPQKVVWHGSNTHGVRLEDKYCEAWRTADMAVTGLASSLSSGKILDQRAYSCANKLIVLC
IENSLMTDARK
Download sequence
Identical sequences ENSDORP00000004740 ENSDORP00000004740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]