SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004763 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004763
Domain Number 1 Region: 213-390
Classification Level Classification E-value
Superfamily MIR domain 1.7e-39
Family MIR domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004763
Domain Number - Region: 2143-2208
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000106
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number - Region: 1409-1529
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0015
Family SPRY domain 0.028
Further Details:      
 
Domain Number - Region: 655-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0166
Family SPRY domain 0.049
Further Details:      
 
Domain Number - Region: 3172-3319,3373-3398,3465-3470,3818-3842
Classification Level Classification E-value
Superfamily ARM repeat 0.0955
Family PBS lyase HEAT-like repeat 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004763   Gene: ENSDORG00000005086   Transcript: ENSDORT00000005089
Sequence length 4951
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6510:2600:281196:1 gene:ENSDORG00000005086 transcript:ENSDORT00000005089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWSCSALPPFTKSSRSCAWRPKALATDCASWSPHPIPRMSPQTCPSAPLSWTSPCPCV
PCKRCWPTPWRNRKGQVDVEKWKFMMKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTS
RSSTDKLAFDVGLQEDTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLSY
GTGLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQR
RTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGRYLSLLEDKNLLLM
DKEKADVKSTAFTFRSSKEKLDVGIRKEVDGMGTSEIKYGDSVCFIQHVXXXXXXXXXXX
XXXXXXXXXXXXXAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALS
KKAKAPSVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSL
CVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYEL
MVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLQLWAXXX
XXXXXXXXXXXXXXXXXXXXXLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAG
IKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSL
TQAAFTPVPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPC
LVEFCKLPEQERNYNLQMSLETLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQLTSGYK
PAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYAL
LDDRTKKSNKDSLREAVRTLLGYGYSLEAPDQDHXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIPVCSLGVGQVGRMNF
GKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTT
DSSPCLKVTQKSFGSQNSTSDIMFYRLSMPIECAEVFSKTVPGGLSGAGLFVPKNDLEDY
DTDSDFEVLMKTAHGHLVPDRIDKDKEATKSEFNNHKDYAQEKPSRLKQRFLLRRTKPDY
STSHSARLTEDVLADDRDDYEYLXXXXXYYYSVRIFPGQEPANVWVGWITSDFHQHDPGF
DLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAASGL
LTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKN
PVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINMLLNFKDDKSECPCPEEIRDQLL
DFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLKKKQAEKPVASDATKSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTI
NLLASLGQIRSLLSVRMGREEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVN
VLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGS
TPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGER
YLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIKIAEDP
SRDGPSPTSGSSRTLDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAKGEAIR
ISEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNVVEPDMSAGFCPDHKAAMVLFLDRVY
GIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFA
GTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDV
PLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGTTSEEELHLSRKLFWGIFDALSQKK
YEQELFKLALPCLSAVAGALPPDYMESNYVNLMEKQSSMDSEGNFNPQPVDTSNITIPEK
LEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIK
ESLKTMLAWGWRVERTREGDSMALYNRTRRISQTSQVSVDTAHGYSPRAIDMSNVTLSRD
LHXXXXXXXXXXXXXXXXXXXXELESKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVR
HRISLFGNDATSIVNCLHILGQTLDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDVQVSCYRILTS
LYALGTSKSIYVERQRSALGGCLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAALS
LPANVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVVLPMLCSYMSRWWEHGPEN
NPERAEACCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLK
THFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRF
VDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTK
SKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPVGLNICAPGDQELIALAKNRF
SLKDTEDEVRDIIRTNIHLQGKLEDPAIRWQMALYKDLPNRTEDASDPERTVERVLDIAN
VLFHLEQKSKYTGRRYYSLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRA
VNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKRVDPLHQLILLFSRTAL
TEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGA
AEMVLQTISASKGDTGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGL
MQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQN
YLRTQTGNNMTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQV
FNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQK
DMVVMLLSMLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXFSSYWGVFLTLLHFVASVCRGFFRIVCSLLLGGSLVEGAKKIKVAELLANMPD
PTQDEVRGDAEDGERRPPETALPSEDLMDLKELTEESDLLSDIFGLDLKREGGQYKLIPH
NPNAGLGDLMANPTPVPDMQEKLQEQKAKEEKEEKEEIKSEPEKAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVSTSSVVEGKELPTRSPSENTHVAISLDSSTPHIITVHYVLEESSGYMEPTLRILA
ILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVIN
TQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSA
VLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTI
LSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIIDAFGELRDQ
QEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLXXXXXXXXXXXXXXXXX
ESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences ENSDORP00000004763 ENSDORP00000004763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]