SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004766 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004766
Domain Number 1 Region: 39-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-31
Family MAM domain 0.018
Further Details:      
 
Domain Number 2 Region: 372-506
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-22
Family MAM domain 0.038
Further Details:      
 
Domain Number 3 Region: 1805-1866
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000376
Family ATI-like 0.076
Further Details:      
 
Domain Number 4 Region: 1042-1092
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000719
Family ATI-like 0.046
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004766
Domain Number - Region: 2218-2265
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00018
Family ATI-like 0.022
Further Details:      
 
Domain Number - Region: 2255-2318
Classification Level Classification E-value
Superfamily FnI-like domain 0.00387
Family Fibronectin type I module 0.034
Further Details:      
 
Domain Number - Region: 2635-2687
Classification Level Classification E-value
Superfamily FnI-like domain 0.0115
Family Fibronectin type I module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004766   Gene: ENSDORG00000005093   Transcript: ENSDORT00000005092
Sequence length 2696
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3748:1340:51860:1 gene:ENSDORG00000005093 transcript:ENSDORT00000005092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYAVWTLVLIVGAVLSWTQNPLEWEVFVRRAVDNSIITKCDFEDDSKPLCDWSQVSADD
GDWIRTSGPSPTGISGPPGGYPTGEGYYLHMDSRTFRTGGVARLRSPDIWEHGPLCLYFA
YHMFGLSWGAQLRLLLLMGTQDNRPKVLWKHVNTQSPSWMPTTVTLPAELILPSRLIFEG
MRGNTPFLDISLDALSIHRGTCNRVCMMKMCTFDTLNDLCGWSWIPTPTGAKWVQKNGSS
GKTGVGPEDDFSSPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXFSGQPGPTWKPVSVNYTGQGQIQFTVVGVFGIIPEPAVAVDA
ISIAPCGESVPHCDFEDSAHPFCDWSHVFSDGGHWAWGSKNLPTIVGGSKDSTYEGEHYI
YFEADKFSRAGQSVRLGSRPFCAPGDICVEFAYHMNGLGKGSMLKLLLGSPAGSSPITLW
HRVGAQGPGWLNSSVTVPSGYQQPMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSCPPNAHYEPCMCPASCENPKPTCEPHCSSGCICNQGFL
FSQNNCISALSCHCFYSNRYYQPGEEWFNSNCSERCRCSSGGQIECQKAQCKANMVCELR
DHKHGCYPFAGSATCVVYGALHYVTFDERHIGFTGRCTYILTQSCHNKTTEPFFRVTAEN
EKRALEGVSCLSKVYVALSETSITLLKGRRILVGNEHVDLPVMLSNDTYMSLSGRFIVLQ
TPFGLTVRWDGDQQLFVTVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXCEKETKLSPCAPEVLTTLSGPAFCGQLTLPDGIFETCLNRLKATSFFDNCV
SDMCSFQGVQTMLCAHISTLTAICQSAGLPVRPWRESSFCXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGDVWYKPNCKE
ICECGSNHKIRCHAWNCTAQETCRWKDGSYGCHALSAGTCLVSGDPHYLTFDGALHHFTG
TCNYVLSKPCWTGFQDNYFVVSASNENRGGSLEASYIKAVHLVVFDLRISLFKGYTVTVE
GRQVALPVWLFQDRVTIRFSGSFILFHTDFGLQVRYDGNHLVMVSVPSSYAGRLCGMCGN
YNNNSLDDNLKPDKRPASNSSQLGASWKIAESSDPGCFVTGSSPVNCQDTSTSTIWNKNC
GILLNPMGPFASCHLMVSPQPSFASCVHSQCESKGNALSLCHSLQAYASLCAQAGQAVAW
RNNTFCPLKCLPNSSYKPCANPCPDACLSLNSPTYCPVLPCVEGCECQRGYILSGHSCVP
PSYCGCRDPEGFYHMVGESWYPEKTCRVLCNCWISNNITCGPAACEASQMCSSQDGLFHC
QTIGTGVCHVSEDVRYVSFDGVGQPIFGTCTHILVKVCDPSSKLPFFEISAKSESQEGKP
FRIFRVYITVFSYQISLQKGHSVMVNDEPVTLPTNSKIHGVKITSSGDYTLVDIKNGVQV
KYGGDHFLEIKVPAAYHKKLCGVCGNFNGQKEDDLMMPNNELAEEAHDFMDSWQNRDIDP
TCQAPEEFTQVEVEETTHEKCRPADLGKARQACQEALQTPAWAECATRVDVKPYILGCID
KICEFGGRSSGLVHTLCETLQGFESACRNEGLKTPIWRNSTFCXXXXXXXXXXXXXXPSC
TPSCRELDCESASVRVPLTCTEGCICQTDYVLNEGQCVPKSSCDCRTAEGAVIAVNKTWI
SSGCTQKCMCSEGRVQCRSFQCPYGSHCQNGENDNSFCAADKSDQCTILGDPYYRTFDRF
GYHFPGRMTYILVKTVESLPEGLESLLVEGRNKLTKSSSPTLYEVIIMVYGYKVQLQTNL
ELVVNDQKMSIPYTPIEELEVTLRGTRIFLITAFQLIVSYDGKNLAXXXXXXXXXXXXXX
XXXXXDRDKTNDFMLPSGRVTQNIHVFVSSWTVNPQDSLLRFPRALPEQAEGEEKRTCHP
QCSPEQLTLIHASQACRVLVDPQGPFATCHQIIDPEPFQEHCVFDLCADQDPQAQEELRC
RALSGHGVPGQHGVQELHDALPGILCQPGGRQGLGSLLRRLCQPPRPHLQWHQEPPQARC
GCTAAGIYYQLGDSFVTEDCAQHCTCASSGLLLCEPFGCSAGEICTLANFTRGCFR
Download sequence
Identical sequences ENSDORP00000004766 ENSDORP00000004766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]