SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004828 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004828
Domain Number 1 Region: 2207-2462
Classification Level Classification E-value
Superfamily BEACH domain 1.01e-109
Family BEACH domain 0.00000000011
Further Details:      
 
Domain Number 2 Region: 108-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.51e-33
Family Clostridium neurotoxins, the second last domain 0.028
Further Details:      
 
Domain Number 3 Region: 2050-2157
Classification Level Classification E-value
Superfamily PH domain-like 3.5e-30
Family PreBEACH PH-like domain 0.00000224
Further Details:      
 
Domain Number 4 Region: 2580-2829
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-24
Family WD40-repeat 0.0094
Further Details:      
 
Domain Number 5 Region: 417-493,647-873
Classification Level Classification E-value
Superfamily ARM repeat 0.000000396
Family Plakophilin 1 helical region 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004828   Gene: ENSDORG00000005154   Transcript: ENSDORT00000005160
Sequence length 2836
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5417:3220:464027:1 gene:ENSDORG00000005154 transcript:ENSDORT00000005160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVG
LIEQVLLKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLS
VLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKP
YLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWR
NSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALN
PAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCL
ESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQ
VETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFA
KYLDGLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIYKLLASKS
ESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILT
EQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSN
SRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVW
VDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQTTGAKGGM
EIREIEDLSQSQSPESETDYPVSTDPRDLLMSTKVSDDILGNTDRPGNGVHVEVHDLLVD
IKAEKVEATEVKLDDMDLSPETLVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGVI
KNNEEKDNGPLITLADEKEELPNSTTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHL
GVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSISERDLASSAKGLEYAEMT
ATTLETESSGSKVVPNIDAGSIISDTERSDDGKESGKEIRKIQTTATTQAVQGRSITQQD
RDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVW
RSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCV
AVRNCLECRQRQRDRGNKSSHGSSKPQEVSQSVTATTASKTPLENVPGNLSPIKDPDRLL
QDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETSRTGSQPGR
NIRQEINSPTSTVVVIPSIPHPSLNHGFLAKLIPEQSFAHSFYKETPTAFPDTIKEKETP
TPGEEIQIESSIPHTDSGIGEEQVASILNGAELETTTGPDAMSELLSTLSSEVKKSQESL
TEHPNELLKPAPSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKREAQA
ILPMQFHSFDRSVVVPVKKPPPGSLAVTTVGATSAGSGLPTGSTSNIFAATGATPKSMIN
TTGAVDSGSSSSSSSSVNGATSKLPAVQTVAPMPEDSAENMXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFI
ELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESQCAQYAADRREEEKMC
DHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTEEDIVKSKKAFRSQAIVNQNAETELMLEGDDDAVSLLQ
EKEIDNLAGPVVLSTPAQLIAPVVVAKGTLSITTTEIYFEVDEDDPAFKKIDTKVLAYTE
GLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGT
SYGLPQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTYNDLNQYPVFP
WVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYST
STSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSIARSWRTSQRDTSDVKELIPEFYYL
PEMFVNSNGYHLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLI
FGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHP
PRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCS
RLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAH
CFVVTADNRYILICGFWDRAKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLL
WYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTIT
GDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSINGKLLAQMEINDSTRAILL
SSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVA
FNIDFNRWHYEHQNRY
Download sequence
Identical sequences ENSDORP00000004828 ENSDORP00000004828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]