SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004836 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004836
Domain Number 1 Region: 98-280
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.57e-57
Family GMC oxidoreductases 0.0061
Further Details:      
 
Domain Number 2 Region: 2-96,279-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.04e-45
Family FAD-linked reductases, N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004836   Gene: ENSDORG00000005168   Transcript: ENSDORT00000005168
Sequence length 359
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4281:211586:217429:-1 gene:ENSDORG00000005168 transcript:ENSDORT00000005168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRWSAACAYLHPALSRPNLRAEVHTLVSRVLFEGTRAVGVEYFKNGQSHRAYASKEVILS
GGAINSPQLLMLSGVGNGDDLKKLGIPVVCHLPGVGQNLQDHLEIYVQQACTRPITLHSS
QKLLRKVRIGLEWLWRFTGEGATNHLETGGFIRSRPGVPHPDIQFHFLPSQVIDHGRVPT
QQEAYQVHVGPMRATSVGWLKLRSTNPQDHPVIQPNYLSTETDIEDFRHCIKLSREIFAQ
EALAPFRGEEIQPGSHVQSDKEIDAFVQAKVDSAYHPSCTCKMGQPSDPTAVVDPQTRVL
GVENLRVIDASIMPSIVSGNLNAPTIMIAEKAADIIKGQPVLWDKDVPVYKPKTLATQR
Download sequence
Identical sequences ENSDORP00000004836 ENSDORP00000004836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]