SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004881 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004881
Domain Number 1 Region: 93-360
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.15e-57
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 47-109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000125
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004881   Gene: ENSDORG00000005220   Transcript: ENSDORT00000005219
Sequence length 361
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6432:10220:14795:1 gene:ENSDORG00000005220 transcript:ENSDORT00000005219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPNTALAERQAKMSALAAAITALLLWGQVFAVDLGNDATDIADDSCPKPPEIANGYVEH
SVRYRCQTYYRLRSGGDGVYTLNSEKQWVNEAVGGKLPECEAECGKPRYPVDQVQRIIGG
SLDAKGSFPWQAKMVSRHSLTTGATLINEQWLLTTAKNLFLNHTENATADDIAPTLRLYL
GRNQQVEIEKVIFHPNHSMVDIGLIKLKEKVPINERVMPICLPSKDYVQEGRLGYVSGWG
RNVNFRFTERLKYVMLPVADQQKCVMHYEGSTEPEKKTPKSPVGVQPILNEHTFCAGLSK
YQEDTCYGDAGSAFAVRDLEEDRWYGVGILSFDKSCTVAEYGVYVNVREILGWIQDTIAN
N
Download sequence
Identical sequences ENSDORP00000004881 ENSDORP00000004881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]