SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004941 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004941
Domain Number 1 Region: 7-51
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000317
Family SPRY domain 0.067
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004941
Domain Number - Region: 120-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.087
Family SPRY domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004941   Gene: ENSDORG00000005280   Transcript: ENSDORT00000005281
Sequence length 538
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2415:19708:78325:-1 gene:ENSDORG00000005280 transcript:ENSDORT00000005281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPN
LYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQAQIDRFPIGDREGEWQTMIQK
MVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYP
SLLERNPNLLFTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEMEDCDTEMKVDSSQLRRQLCG
GSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDP
IQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCAFATVEDYLH
Download sequence
Identical sequences ENSDORP00000004941 ENSDORP00000004941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]