SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004960 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004960
Domain Number 1 Region: 258-417
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.27e-55
Family Hemopexin-like domain 0.00000833
Further Details:      
 
Domain Number 2 Region: 99-247
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-51
Family Matrix metalloproteases, catalytic domain 0.00000213
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004960
Domain Number - Region: 64-87
Classification Level Classification E-value
Superfamily PGBD-like 0.000106
Family MMP N-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004960   Gene: ENSDORG00000005305   Transcript: ENSDORT00000005304
Sequence length 418
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1684:730:7308:-1 gene:ENSDORG00000005305 transcript:ENSDORT00000005304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLLILFLQVAASGAAPLASVEEQVVAFAKAYDCFYSVIEDFPRAGRKTNFLEDLHMQ
CSLLKVTGLDSATLKMMHTPRCGEPEVYYFQTLPRRPGWIHNYTPDLKNEDVDYAIEKAF
QVWSDVTPLKFKKTYAGDADIVILFAHREHGDFSSFDGRGGILAHAYGPGSGIGGDAHFD
EAEIWSDNFKGHNLFLVAVHELGHSLGLDHSNDPEAIMFPTYSYRDPKTFRLSADDKRDI
QSLYGVPLTYQPKPSPESQVPDACDPNLSFDAVTTMGDKILFFKDWFFWWKRPERSATGV
SSIHSMWPSLPAGIQAAYEIKAQNQIFLFKDDKFWLINNLRPQLNYPKSIYSLGFPNSVK
KIDAALFNPLYYKVYFFVGNQYWRYDVRRQLMDPTYPKLISKYFPGIKNEIDAVFYFK
Download sequence
Identical sequences ENSDORP00000004960 ENSDORP00000004960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]