SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004962 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004962
Domain Number 1 Region: 68-186
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.62e-23
Family Frizzled cysteine-rich domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004962   Gene: ENSDORG00000005306   Transcript: ENSDORT00000005306
Sequence length 784
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2557:1243:21806:1 gene:ENSDORG00000005306 transcript:ENSDORT00000005306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPARRPELQLLGLLLLLLGGLGRGAALSGNRTGPESRIGGGNAKRSAAVTGPPSLL
SHCGRAAPCEPLRSNVCLGSALPYGTSTLLVGDSDSQKAHGKLVLWSGLRNAPRCWAVIQ
PLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQ
NIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGL
CTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRL
GEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLL
TWSLPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFGFLAFGFVLITFSCHFYDFFNQAEWERS
FRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLL
IWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGL
AFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEQANLWLVEAEISP
ELEKRLGRKKKRRKRKKEVCPLVAASELRPPAPATSAVPRLPQLPRQKCLVAAGAWGAGE
SCRQGAWTLVSNPFCPEPSSYQDPFLPSAPAPTAWAQGRHQGLGPIHSRTNLMEAELMDA
DSDF
Download sequence
Identical sequences ENSDORP00000004962 ENSDORP00000004962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]