SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004979 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004979
Domain Number 1 Region: 311-887,932-1101
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.25e-205
Family Motor proteins 0.0000000259
Further Details:      
 
Domain Number 2 Region: 3-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-51
Family Ankyrin repeat 0.0000703
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004979
Domain Number - Region: 1465-1596
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0942
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004979   Gene: ENSDORG00000005318   Transcript: ENSDORT00000005323
Sequence length 1691
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_246:6181:260953:1 gene:ENSDORG00000005318 transcript:ENSDORT00000005323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLLKEGADPHAVGFSGGSLLHLCARYDNAFIAEILIEKGVNVNHQDEDFWTPMHIACAC
DNPDIVLLLLLSGADVLLQDVNGNIPLDYALEGTESSSILLTYLDENGVDLTSLRQMKLQ
RPLNMLTDVKHFLSSGGNVNEKNDEGVTLLHMACTSGYQEVVSLILEHGGDLNTADNQYW
TPLHLAAKYGQTHLVKLLLLHHANPCLVNCNEEKPSDIAASAFIEKMLLKAEMAWEGKMQ
EPLPQGSLPGPIFTEEEAFEEEGQEVPALSSKLNPLVLPIAKQDSLLEKDTMFKDTAKGA
CKQQTEDSSPEHSCLNSSNRPEQVQLMPPAPNDDLATLSQLTDSSLLYEIQKRFANNQVY
TFVGDVLLLVNPFKDLPIYSTMVSQLYLSRSGTRSPSLPPHLFSCAERAFHHLFEEQRPQ
CFILSGERGSGKSEASKQILKHLTCRTGSSRAMFHSRFKHAMCILEAFGHAKTPLNDLSS
CFVKYWEVQFCEQNRHVTGARIYTYMLEKSRLVSQPVGQSNFLIFYLLMDGLSAEEKYRL
HLNKLSAHRYLRQTTGEEVSTPEHSVNREKLTLLKQALNVIGFSSLEVENLFMILAAVLH
LGDIRFTTLTNTDAAFVSDLQLLEQVAGMLQVSTDDLASALTTDVQHLKGDLIMRRHTTA
MAEFYRDLLAQSLYSRLFGFLVNSINGCLQSPDNHTSTHTLDIGILDIFGFEEFQKNEFE
QLCVNMTNEKMHHYINEVLFLQEQTECVQEGVTMETAYSPGNQTAVLDFFFQKPSGFLAV
LDEESQVIGSGEPNLPKKLQSLLESSNTNTVYSPVKDGNGNVALRGPGTAFTVMHYAGRV
MYDVVGAIEKNKDSLSQNLLFVMKTSENVVINHLFQSKLSHTGALIPSYPSFKFRGHKST
LLSRKITTASXXXXXXXXXXXXXLLKKKGTSTFLQRLERRDPVTRASQLRKSLAEITGKL
QQGGLHFVHCIKPNSSQLPDTFDPFYVSAQLQYIGVLEVVKVFRHGFPARLSFSNFLARF
EPLAAVILGEKKDLCTEERCRLVLHHCKLQGWQMGIHKVFLKYWHMDQLSDLCLQLQQRI
ITCQKVIRGFLARQHVLQKMSVKRHEITSIKNFLEDTEDMALRTYDALVIQNASDIAREN
DRLRKEMHAPYHREKEEARSKQEEGVKRAEDQSGCRHFQSGSIPVPVEGLAQALAAAPSI
RSPSLHSAFSLEEGSSLPSPRKQPPPKPKRDPNTRLSASYEAVSACLFTSSEALTRRRPH
SDDYSAVKKIPPRKPKRSPNTKLSGSHEEIWGPRPLGAAGAGAPGSSALAPLRPPLPASW
GGEDEDEDAEPVYIEMVGNAGGAGAAGSPEHEAVYEEMKFFPPEEAGGPGLGSGPATPRD
PGDIPAPFPNLLPHRPPPLVFPPAPAGGSPASDESPLTPLEVKRLPVLDTNLKYPVPPDG
AGPGSPPADGQGPAPARRAPPPAAPPPPPAAPPRAPPRPGPAPPPPPGPARPPGPVASPP
APHRPPELAGLLLAGRGALRRSAAGRRIREPEGFETNMNLTSRDDPSTLEIASETQDRNA
NTSGIQLSNSLSSAVTAENGNPVSNGQPDDDSFPQLCESRPTPPPFQRHRESHTTQVIHH
LRLSENESVALRELLDWRRKLCEEQEDWQHVLQHAEPRTPPPPPCRKPTLLKKPETASCS
RLPSELWDSTI
Download sequence
Identical sequences ENSDORP00000004979 ENSDORP00000004979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]