SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004999 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004999
Domain Number 1 Region: 151-336
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 4.88e-83
Family Tubulin, C-terminal domain 0.00000000921
Further Details:      
 
Domain Number 2 Region: 2-150
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 3.01e-62
Family Tubulin, GTPase domain 0.0000000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004999   Gene: ENSDORG00000005346   Transcript: ENSDORT00000005344
Sequence length 354
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5597:36945:38009:1 gene:ENSDORG00000005346 transcript:ENSDORT00000005344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTGAGNNWAKGHYTEGAELVDSVLDVVRKECEHCDCLQGFQLTHSLGGGTGSGMGTLLIS
KIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFR
TLKLTTPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPL
TARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGPMSMKEVDEQMLAI
QNKNSSYFVEWIPNNVKVAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFSAMFRRKA
FLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVNDGEEAFEDYEDDEINE
Download sequence
Identical sequences ENSDORP00000004999 ENSDORP00000004999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]