SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005027 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005027
Domain Number 1 Region: 611-723
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.02e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00048
Further Details:      
 
Domain Number 2 Region: 68-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.58e-34
Family G proteins 0.00000224
Further Details:      
 
Domain Number 3 Region: 735-825
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-16
Family Ankyrin repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 346-405
Classification Level Classification E-value
Superfamily PH domain-like 0.000000118
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005027   Gene: ENSDORG00000005374   Transcript: ENSDORT00000005374
Sequence length 856
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4315:299:242493:1 gene:ENSDORG00000005374 transcript:ENSDORT00000005374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNS
QEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL
LIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEVPLVLVGTQD
AISSTNPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKQQLSIR
PCKSLPSSPXXXXXXXXXXXXXXXXXTSNGGGSLSDYSSSVPSTPSTSQKELRLDAPPTA
STPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSL
NKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPIS
SPKTNGLSKDMSGLHVSPNSGNVTSASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQW
SEATVIANAAISSDTGLGDSVCSSPSISSSTSPKLDPPPSPHANRKKHRRKKSTSNFKAD
GLSGTAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
RLTSQSEAMALQSIRNIRGNSHCVDCDAQNPNWASLNLGALMCIECSGIHRNLGTHLSRV
RSLDLDDWPMELIKVMSSVGNELANSVWEESSQGRTKPSLDSTREEKERWIRAKYEQKLF
LAPLPCTELSLGQHLLRATADEDLRSVILLLAHGSREEVNETCGEGDGRTALHLACRKGN
VVLAQLLIWYGVDVMARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLSR
KNNNRNNSGGRVPSII
Download sequence
Identical sequences ENSDORP00000005027 ENSDORP00000005027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]