SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005125 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005125
Domain Number 1 Region: 128-372
Classification Level Classification E-value
Superfamily vWA-like 1.43e-77
Family Integrin A (or I) domain 0.000000117
Further Details:      
 
Domain Number 2 Region: 370-457
Classification Level Classification E-value
Superfamily Integrin domains 4.39e-25
Family Integrin domains 0.00025
Further Details:      
 
Domain Number 3 Region: 627-704
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.14e-16
Family Integrin beta tail domain 0.0016
Further Details:      
 
Domain Number 4 Region: 21-50
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000115
Family Plexin repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005125
Domain Number - Region: 504-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0402
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005125   Gene: ENSDORG00000005479   Transcript: ENSDORT00000005479
Sequence length 787
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1945:14376:81325:-1 gene:ENSDORG00000005479 transcript:ENSDORT00000005479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLLFLFLGRHDHVQGGCAVGGAETCGDCLLIGPQCAWCSQEFTHPSGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKNSSDIVQITPQSLILKVRPGGKQTL
QVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEKP
VSPFMKTTPEEIANPCSSVPYFCLPTFGFKHILPLTNDAERFNEIVKKQKISANIDTPXX
XXXXXXXXXXXXEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDNKNEY
YMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVRLYENYAKLIPGATVGLLQKDSGNIL
QLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLIPHQKKCSHMKVGDTASFNVTV
TVPNCERRSRHILIKPVGLGDTLEILVSSECDCDCQKEVEVNSSKCHNGNGSFQCGVCAC
NPGHMGPHCECDEDTLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDN
FSCVRHKGLLCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSCIECHLSTDGQAREECADKCKLIGATISEEED
FSKDSSVSCSLQGENECLITFLITTDNEGKTIIHNINEKDCPKPPNILMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQK
VDLSSDG
Download sequence
Identical sequences ENSDORP00000005125 ENSDORP00000005125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]