SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005151 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005151
Domain Number 1 Region: 115-194,224-269,319-417
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.19e-38
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000806
Further Details:      
 
Domain Number 2 Region: 458-593
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.23e-16
Family Ricin B-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005151   Gene: ENSDORG00000005508   Transcript: ENSDORT00000005507
Sequence length 600
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1682:8674:287423:-1 gene:ENSDORG00000005508 transcript:ENSDORT00000005507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRMALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMER
TPQHLLKEIILVDDNSSNEELKEKLTEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXYLNPPKSENTPIRSPALIGCFIVDRQYFQEIGLLDEGMEVYGGENVELGIRVW
QCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMAWNIPQE
DSGIDIGDISARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTDLCLDQG
PDTENVPIMYICHGMTPQNVYYTSSQQIHVGVLSPTIDDDDNRCLVDVNSRPRLIECSYA
KAKRMKLHWQFSQGGPIQNRKKRCLELQENSDLEFGYQLVLQKCSGQHWSITNVLRSLAS
Download sequence
Identical sequences ENSDORP00000005151 ENSDORP00000005151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]