SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005153 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005153
Domain Number 1 Region: 1117-1421
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.16e-81
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000983
Further Details:      
 
Domain Number 2 Region: 879-1068
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-72
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000797
Further Details:      
 
Domain Number 3 Region: 2-158
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-39
Family MAM domain 0.00000559
Further Details:      
 
Domain Number 4 Region: 359-556
Classification Level Classification E-value
Superfamily Fibronectin type III 8.17e-25
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 256-387
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000131
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 6 Region: 162-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000568
Family I set domains 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005153   Gene: ENSDORG00000005507   Transcript: ENSDORT00000005509
Sequence length 1423
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4051:32028:325561:-1 gene:ENSDORG00000005507 transcript:ENSDORT00000005509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCTFDDGPGACDYHQDLYDDFEWVHVSAQEPLYLPPEMPQGSYMIVDSSNHDPGEKARLQ
LPTMKENDTHCIDFSYLLYSQNGLNPGTLNILVRVNKGPLANPIWNVTGFTGRDWLRAEL
AVSTFWPNEYQVIFEAEVSGGRSGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATF
QCIATGRDAVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQS
ERGSGVSNFAQLIVREPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTS
GSWTETHAVNAPTYKLWHLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPK
TLKIAEIQARRIAVDWESLGYNITRCHTFNVTICYHYFRGHNESKADCLDMDPKAPQHVV
SHLPPYTNVSLKMILTNPEGRKESEETIIQTDEDLPGPVPIKSLQGTSFENKIFLNWKEP
LDPNGIITQYEVSYSSIRSFDPAVPVAGPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRAS
TVKGFGPATAINVTTNISAPTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAYQIVV
EELHPHRTKREAGAMECYQIPITYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQ
GFWNPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDRVVKI
AGISAGILVFILLLLVVILIVKKSKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHA
EDPLSITFMDQHNFSPRLPNDPLVPTAVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFFEGQSASWDVAKKDQNRAKNRYGNIIA
YDHSRVILQPVEDDPSSDYINANYIDIWLYRDGYQRPSHYIATQGPVHETVYDFWRMVWQ
EQSACIVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRAYN
EIREVKQFHFTGWPDHGVPYHATGLLSFIRRVKLSNPPSAGPIVVHCXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQYIIHDAILEACLCGETAIPVCEFKA
AYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCL
PFLITIDGESSNYINAALMDSYRQPAAFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEV
DLSQGCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLMVQQFQYL
GWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMV
KRQNVVDVFHAVKTLRNSKLNMVEASEQYRFCYDVALEYLESS
Download sequence
Identical sequences ENSDORP00000005153 ENSDORP00000005153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]