SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005183 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005183
Domain Number 1 Region: 23-136
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.89e-38
Family Frizzled cysteine-rich domain 0.0000884
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005183   Gene: ENSDORG00000005541   Transcript: ENSDORT00000005541
Sequence length 650
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4925:29020:45440:-1 gene:ENSDORG00000005541 transcript:ENSDORT00000005541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMLTFLLTCVSLPLIRGHSLFTCEPITVPRCMKMTYNMTFFPNLMGHYDQGIAAVEMEH
FLPLANLDCSPNVETFLCEAFVPTCTEQIHVVPPCRKFCEKVYSDCKNLIDTFGIRWPEE
LECDKLQYCDDTVPVTSDPHTEVLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIEQ
CAPPCPNMYFQSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNSTACNRADEKLDLGDTVVLGSQNKACSVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFIG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYIYELVNRFTWEITWVSDHCRQYHIPCPYQAKTKARPDLALFMIKY
LMTLIVGISAVFWVGSKKTCAEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSSVAITDHDYLGQETLTEIQTSPEASMRDL
RTDRACTPKLREQDHGEPASPAASSSKLSGEQVDKKSRAGSVCEGAQSEG
Download sequence
Identical sequences ENSDORP00000005183 ENSDORP00000005183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]