SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005198 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005198
Domain Number 1 Region: 6-168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.65e-31
Family Pentraxin (pentaxin) 0.000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005198   Gene: ENSDORG00000005557   Transcript: ENSDORT00000005556
Sequence length 172
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_8415:6:524:1 gene:ENSDORG00000005557 transcript:ENSDORT00000005556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRAYSDLSRAYSLFSYSYVEGKDNELLIYKERTGDYSLHIGGRKVTFKVMETLLSPVHLC
ASWESSTGIVEFWINGKPLVKKGLRQGYTIEPRGSIVLGQEQDSFGGEFDKSQSFVGEIG
DLDMWDSVLSPEEILFEYQGSTTNPTYPNILNWKALHYEVNGYVIIKPLVWN
Download sequence
Identical sequences ENSDORP00000005198 ENSDORP00000005198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]