SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005241 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005241
Domain Number 1 Region: 2115-2415
Classification Level Classification E-value
Superfamily BEACH domain 2.75e-129
Family BEACH domain 0.0000000000153
Further Details:      
 
Domain Number 2 Region: 2524-2774
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.11e-35
Family WD40-repeat 0.006
Further Details:      
 
Domain Number 3 Region: 2004-2110
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-28
Family PreBEACH PH-like domain 0.0000027
Further Details:      
 
Domain Number 4 Region: 395-498,577-868
Classification Level Classification E-value
Superfamily ARM repeat 1.77e-19
Family Plakophilin 1 helical region 0.065
Further Details:      
 
Domain Number 5 Region: 144-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000135
Family Clostridium neurotoxins, the second last domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005241
Domain Number - Region: 270-317
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000376
Family Pentraxin (pentaxin) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005241   Gene: ENSDORG00000005601   Transcript: ENSDORT00000005602
Sequence length 2789
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6503:3429:383725:-1 gene:ENSDORG00000005601 transcript:ENSDORT00000005602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVGGQFDLEMNFIIQEGESIICMVELLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVG
LVEKVLEKIEKVDSMIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAIALPPIAKWPYQSGFTFHTWLRMDPVNNINVDKDKP
YLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXTFDKCFLGSSETADANRVFCGQMTAVYLFSDALN
AAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCL
ESSPKDSPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYKQYLSDE
VDLTICTTLLAFIMELLKNSIATQEQMLACKGFLVIGYSLEKSSKSHVSRAVLELCLAFS
KYLSNLQNGMPLLKQLCDHILLNPAIWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVG
TVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPNQKEIFSLRAFLLMFIKQLVMKDSGV
KEDELQAILNYLLTMHEDDNLMDVLQLLVALMAEHPNSMIPAFDQRNGLRVIYKLLASKS
EGIRVQALKAMGYFLKNLTPKRKAEVMLGHGLFSLLAERLMLQTNQITMTTYNVLFEILI
EQICTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNN
SRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVW
VDTLSITHSKVTFEIHKENLATIFREQQGKVDEEIGLCSSSPVQAVTGPSRDIDVSVASQ
SSDKKDSPVPPHLTRNSDGNLSIEKASSAEFASNIELQAHDTCNEERKTEQDNQELLDEV
TLEEIPINETNDASDLEASSGAAEPVTAFSDSSKTPGKDSRTISEVTTSVSSPSEEDASE
MPELLERSVEEDDDDYVELKVEGSPAEETSLPTEIQDHSSTLAASEASETLEMVSNDHKL
ITKEEAPVTEKQTDTETGSSKESGFLTMTASESLATSPETTVSQTTVQSDTDQVLEEGKE
ATNLAGDTKSIIDSSSQVFEAAATSEQKIAKLDVSSVASDTEKLELKASTNTEAPQPHRH
VHEMSKQQEQPGQGTAAHAVDGQRRDSRSSVFRIPEFRWSHMHQRLLTDLLFSIETDIQM
WRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENI
EPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAV
RNCLECQQHSQLKARGDSAKGLKTIHCLVPLGKLAAKSPVDIVTGGISPVRDLDRLLQDM
DINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQHERQSQSFKETSSEN
GSASLPENIPAAFSPLTLSSVEESVESTSSTRRRDSGLGEETASGLSSHVSVSSPAVPLG
VSAGPDAISEVLCTLSLEVNKSQETKNDGGDELDNKAVPVSKNVNVKDILRSLVNIPADG
VTVDPALLPPACLGALGDLSAEQPVQFRSFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITERLEHALEKAAPLLR
EIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGL
AFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEE
KVCDHLIRAAKYRDHVTATQLIQKMINILTDKHGAWGNSAVSRPREFWRLDYWEDDLRRR
RRFVRNPLGSTHPEATLKTAVEHVSIFKLTNKTADEDILAKGKQSIKSQALGNQNSENEI
LLEGDDDTLSSVDEKDLENLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELFFEVDEEDPN
FKKIDPKILAYTEGLHGKWLFSEIRSIFSRRYLLQNTALEIFMANRVAIMFNFPDPATVK
KVVNCLPRVGVGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREVSNFEYLMFLNTIAG
RSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDD
QVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDT
SDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESE
FVSCQLHQWIDLIFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSF
GQTPSQLLIEPHPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLATP
AVITVTANRLFAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIASNTGMHRRQITDLLDQSI
QVHSQCFVITSDNRYILICGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLTRSESYIGGN
CYILSGSRDATLLLWYWNGKSSGIGDNPGSETTTPRAILTGHDYEITCAAVCAELGLVLS
GSQEGPCLIHSMNGDLLRTLEGPGHCLKPKLIQASREGHCVIFYENGCLCTFSVNGKLQA
TVETDDHIRAMQLSRDGQYLLTGGDHGVVMVWQASDFKQLFTYPGCDAGIRAMALSYDQR
CVIAGMASGSIVLFYNDFNRWHHEYQTRY
Download sequence
Identical sequences ENSDORP00000005241 ENSDORP00000005241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]