SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005245 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005245
Domain Number 1 Region: 75-294
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.49e-60
Family Ankyrin repeat 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005245
Domain Number - Region: 3-42
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000189
Family Fibronectin type III 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005245   Gene: ENSDORG00000005607   Transcript: ENSDORT00000005607
Sequence length 305
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6570:6515:26900:1 gene:ENSDORG00000005607 transcript:ENSDORT00000005607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYATKHVVEGLEPRTPYKFRLKVTSPSGEYQYSPVISVSTTXXXXXXXXXXXXXXXXXXX
XXXXXXXXEPISSEHFHRAVNVNDEDLLLRILEGGHVKIDVPNKFGFTALMVAAQKGYTR
LVKLLISNGTDVNLKNGSGKDSLMLACYEGHLDVVKYLRRHGASWEARDLGGCTALHWAA
DGGHCPVIEWMIKEGCEVDVMDTGSGWTPLMRVSAVSGSQKVASVLIDAGADVNVRDKDG
KTPLMVAVLNNHEQLVQLLLDRGADPSVKNEFGKGVLEMARVFGRKNVLSLLEERKKLSR
KSTIH
Download sequence
Identical sequences ENSDORP00000005245 ENSDORP00000005245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]