SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005247 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005247
Domain Number 1 Region: 213-414
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.58e-62
Family Reprolysin-like 0.00000587
Further Details:      
 
Domain Number 2 Region: 433-508
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.14e-21
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005247   Gene: ENSDORG00000005609   Transcript: ENSDORT00000005609
Sequence length 912
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6570:35295:304575:-1 gene:ENSDORG00000005609 transcript:ENSDORT00000005609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASSPTDTESYLVALSAALCTVREARGVSLPDQGRNYEVKVEVAGTSLLSGDLQSPGMS
VSKDHPESLSIRLQLESRELIIHLERNEGLIGSSFTETHYLQDGTDVSLARNYTVSLGHC
YYHGHVQXXXXXXXXXXXXXXXXGLIVFENQTYILEPMKNATNRCKLFPAEDLSGIWGSC
GLHHNTTRLPTPAMSPARTQMQARRHKRETLKMTKYVELVIVADNREQRQGKDLEKVKQR
LIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFSSLHEFLDWRKMKLLPRKSH
DNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNH
DTLERGCSCKTAADKGGCIMNPSTRFPFPMVFSSCSRKDLETSLDKGMGVCLFNLPEIKQ
AFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPEAVCAHGLCCEDCQLKPAGT
SCRSTSNSCDLPEFCTGASPHCPANVYLHDGHPCQGVDGYCYNGVCQTHEQQCVTLWGPG
AKPAPGICFERVNSAGDPYGNCGKDAKSVFTKCEMRDVKCGKIQCQGGASRPVIGTNAVS
IETNIPLQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRRCQNVSVFGVHEC
AMQCHGRVCNNRKSCHCEARWAPPFCDKFGFGGSTDSGPTRQADHQGLALGVLLSVLCLL
TAGFVVYLKRKALIRVLFTHKKTAMEKLRGVRPSRPANGSHPGQAHPAHLGKGPVSRPPC
SRTSKDKRWPPCLGADVSRALHTRAAPRPPSPQRVLLPLPLRQAPRVPSGPARPLPAHPG
LKHTQGPCKPSPPQKPLPANPLSRAPRLTSTTAASVARTPGQQEPGPRPAPTRPAPKYPP
QVSRGTRFAYVK
Download sequence
Identical sequences ENSDORP00000005247 ENSDORP00000005247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]