SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005259 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005259
Domain Number 1 Region: 35-339
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-26
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005259   Gene: ENSDORG00000005621   Transcript: ENSDORT00000005621
Sequence length 505
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2003:3517:13423:1 gene:ENSDORG00000005621 transcript:ENSDORT00000005621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRFAPELVSSSLGLGLLLCSWGCLASAESRAPPEKIAIVGAGIGGTSAAYYLRQKFGKD
VKIDVFEREVVGGRLATLSVQGHDYEAGGSVIHPLNLHMKRFVKDLGLSTIPASGGLMGV
YNGENLVFEESSWFIINMIKLVWRYGFQSLRMHMWVEDVLDKFMRIYRYQSHDYAFSSVE
KLLHAIGGDDYLVLVNQTLQENLQKAGFSEKFLSEMIAPIMRINFGQSTDLNAFVGAVSM
TAADSNLWAVEGGNKVVCSRLIQASKANLISGSVLSVEDKTKTKQRGNPTKMYEVVYKSG
SETKSDFYDIVLVATPLSQKIANIAFLNFDPPIEEFHQNYQQIVTTFVKGELNSTLFSSR
AKDQFGLSTLITDNSDMFINSLGIVNSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAIAGYNAALL
AYHRWNGHTHMIDQDNLYEKLKSEL
Download sequence
Identical sequences ENSDORP00000005259 ENSDORP00000005259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]