SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005266 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005266
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-45
Family Galectin (animal S-lectin) 0.0000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005266   Gene: ENSDORG00000005631   Transcript: ENSDORT00000005628
Sequence length 131
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1060:64119:70330:1 gene:ENSDORG00000005631 transcript:ENSDORT00000005628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVASNLNLKPGECLRVRGEVAPDAKXFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSK
DGGAWGAEQREPAFPFQPGSTVEVCISFDQTDLTIKLPDGHEFKFPNRLNMEAINYMAAD
GDFKIKCVAFE
Download sequence
Identical sequences ENSDORP00000005266 ENSDORP00000005266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]