SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005318 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005318
Domain Number 1 Region: 581-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000643
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 350-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000156
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 3 Region: 505-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000963
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 4 Region: 539-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000105
Family EGF-type module 0.027
Further Details:      
 
Domain Number 5 Region: 47-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000875
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 392-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000339
Family EGF-type module 0.022
Further Details:      
 
Domain Number 7 Region: 318-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000529
Family EGF-type module 0.067
Further Details:      
 
Domain Number 8 Region: 96-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005318   Gene: ENSDORG00000005684   Transcript: ENSDORT00000005684
Sequence length 737
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6212:50781:190699:-1 gene:ENSDORG00000005684 transcript:ENSDORT00000005684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPRRAPAPGAQLLPALALLSLLLGAGPHGGCLASPVPAAPLPAPGACASQPCRNGGVCT
PRSEPGRERAGPAAEPGYSCTCPAGVSGNDCQIVADPCASSPCLHGNCSSSSSSGGDGYL
CLCDEGYEGLHCGQALPSIPASGWTESMSPRQLQPVPATQEPDVILPRSQATVTLPTWQP
KTGQKVVEMRWDRVAVIPDVACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
KVTASGFRQCSLIDGRSVTPLQAPGGLVLLEEMLALGHNYFIGFVNDSVTKSIVALRLTL
VVKASTCAPGDSRPNDVECSGKGKCTTKPSEATFSCTCEDQYMGTFCEEFDACQKKPCQN
QASCLDAVEKQEGSNFTCICLPGYTGELCQSKIDYCVLDPCRNGAKCTSNLSGFSCECPE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGLHC
ELFKDPCANVSCLNGGTCDSEGLNGTCVCAPGFTGEECDIDINECDSNPCHHAGTCLDQP
NGYTCHCPHGWVGANCEIHLQWKSGHMAESLSNMPRHSLYVIIGALCVAFVLMLIILIVG
ICRISRIEYQGSSRPAYEDFYNCRSIDGEFSHAIASIRHARFGKKSRPAMYDVTPIAYED
YSPDDKPLVTLIKTKDL
Download sequence
Identical sequences ENSDORP00000005318 ENSDORP00000005318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]