SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005332 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005332
Domain Number 1 Region: 431-662
Classification Level Classification E-value
Superfamily GFP-like 5.13e-89
Family Domain G2 of nidogen-1 0.00000000235
Further Details:      
 
Domain Number 2 Region: 981-1202
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-46
Family YWTD domain 0.00000000205
Further Details:      
 
Domain Number 3 Region: 813-918
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.35e-24
Family Thyroglobulin type-1 domain 0.00066
Further Details:      
 
Domain Number 4 Region: 705-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 771-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.046
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005332
Domain Number - Region: 674-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family EGF-like domain of nidogen-1 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005332   Gene: ENSDORG00000005696   Transcript: ENSDORT00000005699
Sequence length 1248
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2061:13470:76107:-1 gene:ENSDORG00000005696 transcript:ENSDORT00000005699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAGSGRGAAWTWALRALLLPLLLAGPGRGLGLRGLFPFGPGHGDRELAAGDDVVSPAL
EGALRFYDDSDVASVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNTF
QAALASSNSSSYAIFLYPEEGLQFFTTFSKKDEKQVPAMVAFSKGLVGFIWKSDGPYNIF
ADDQESVENLAKSSNSGLQGVWVFEIGSAATANGVVPADSNLGPDDGTEYVDEDEEYIIV
TPSLGLEDMSTSSFLYEALQRGGAGSHSVPSVLSSGHEATQRPPRSPVERARTRSFQLPV
ERFPQQHVIDVDEVEETGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXSPQRVNGKVKGRIFVGSSQVPVVFENTDLHSYVVMNQGRSYTAISTIPHT
VGYSLLPLAPIGGIIGWMFAVEQDSFKNGFSITGGEFTRQAEVTFVGHPGKLVIKQQFSG
VDEHGHLTINTELEGRVPEIPSGSTVQIEPYTELYHYSSSVITSSSTREYTVTAPGQDSA
APARTHTYQWRQTITFQECPHDRDTQPALPSTQQLSVDSVFVLYNQEERILRYALSNSIG
PVRDGSPDALQNPCYIGTHGCDSNAACRPGPGTQFLCECSVGFRGDGQTCHDIDECKEQP
SVCGSHQICNNLPGTFRCECVEGYSFSDRGTCVAIVDQRPINYCEAGLHDCDIPQRAQCV
YTGGTSYTCSCLPGFSGDGRACQDVDECQPGRCHPDAVCYNLPGSFTCRCKPGYQGDGFR
CEPGEAEKTRCQHERERLLGAAAGGADAQRPQLPGVFVPECDEHGQYAPTQCHSSTGYCW
CVDREGRELEGTRTRPGMRPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXEKVIIGLAFDCVDKMVYWTDISEPSIGRASLHGGEPTTIIR
QDLGSPEGLAVDHLGRNLFWTDSYLDRIEVSKLDGTQRRVLFETHLVNPRGIVVDPVRGN
LYWTDWDRDNPKIETSYMDGRNRRILAQDNLGLPNGLTFDPFSSQLCWVDAGTHRAECLH
PERPGSHRALEGLQYPFAVTSHGKNLYYTDWKTNSVIAVDLAISKETDAFHPHKQTRPYG
ITMALAQCPQGHNYCSVNNGGCTHLCLATPGSTCSCSDNTGVDCIERK
Download sequence
Identical sequences ENSDORP00000005332 ENSDORP00000005332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]