SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005348 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005348
Domain Number 1 Region: 834-956
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.15e-36
Family TSP type-3 repeat 0.000000715
Further Details:      
 
Domain Number 2 Region: 25-203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-33
Family Laminin G-like module 0.0000388
Further Details:      
 
Domain Number 3 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000136
Family VWC domain 0.0051
Further Details:      
 
Domain Number 4 Region: 957-1000
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000222
Family Thrombospondin C-terminal domain 0.00028
Further Details:      
 
Domain Number 5 Region: 808-836
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000589
Family TSP type-3 repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005348   Gene: ENSDORG00000005713   Transcript: ENSDORT00000005715
Sequence length 1000
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6122:262:21860:-1 gene:ENSDORG00000005713 transcript:ENSDORT00000005715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWRLVLLALWAWPWALAGDQHADTTFDLFSLSNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNSDDLGRIIKVMRQKDGFFLTAQLKQDRKSQGTLLALEGPGASQRQFEIISNGP
RDTLDLAYWVEGARHMVSLEDVGLADSQWKNVTVQVAGETYSLYVGCDLIDSFTLDEPFY
EQLTVDRSRMYVARGASRESHFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEANAIHEH
TETLHLSPHLTTDFVGHGVQKRPDVCTHSCEELSNMMSELSGLRLMVNQLSKNLERVSDD
NQFLLELVGGPLKTRNVSGCLQDGRFFAENETWVMDSCTSCTCKKFKTICHQISCPPANC
ANPSFVDGECCPSCSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYLSNANQADHDGDGQGDACDSDD
DNDGVPDDRDNCRLVFNPGQEDADGDGRGDICKDDFDNDNVPDIEDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAV
Download sequence
Identical sequences ENSDORP00000005348 ENSDORP00000005348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]