SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005400 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005400
Domain Number 1 Region: 54-273
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.44e-86
Family Fibrinogen C-terminal domain-like 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005400   Gene: ENSDORG00000005770   Transcript: ENSDORT00000005770
Sequence length 274
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4977:12549:15500:-1 gene:ENSDORG00000005770 transcript:ENSDORT00000005770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGVKPLKKPLTREGIVQAGNLALLAMPLLLLLSTPPCAPQASGIRGDALEKSCLQQPLDC
DDIYAQGYQTDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKL
GFGRADGEYWLGLQNIHLLTLKQKYELRVDLEDFENSTAYAKYVDFSISPNAISAEEDGY
TLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFY
LGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA
Download sequence
Identical sequences ENSDORP00000005400 ENSDORP00000005400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]